DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP005664

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_315684.2 Gene:AgaP_AGAP005664 / 1276347 VectorBaseID:AGAP005664 Length:306 Species:Anopheles gambiae


Alignment Length:261 Identity:81/261 - (31%)
Similarity:128/261 - (49%) Gaps:55/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRS---GSHSCGGSIYSANIIVTAAHCLQSVSASVL---------- 81
            |:|.|...|...||:||:|..:   |:..||||:.:.|.::|||||:...:::|.          
Mosquito    60 RVVNGQEATPGQFPYQIALLSNFLIGTGLCGGSVLTNNYVLTAAHCVIMGTSTVALGGNAIMGAH 124

  Fly    82 ---------QVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL 137
                     |:.|    ::|.|:.|       |.||::..:.|||||:||:|.::|:..|:...|
Mosquito   125 NRDAPEPSQQIIA----FTSAGISA-------HPGYSSANIRNDIAVVRLNSPITFTDRIQPARL 178

  Fly   138 ATYNPA-------NGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTM 195
                ||       .|.:..|||:|..|..|.:..|.:.:.:..:::.:.|.:.......:.:|  
Mosquito   179 ----PARSDTRQFGGFTGTVSGFGRTSDASQATSSVVMFTSNPVMTNADCIAQWNAVLIEPQN-- 237

  Fly   196 IC-AAASGKDACQGDSGGPLV---SGGVLVGVVSWG--YGCAYSNYPGVYADVAVLRSWVVSTAN 254
            :| :...|:.||.|||||||.   .|.:.|||||:|  .|||. ..|.|||.|:....::  .||
Mosquito   238 VCMSGEGGRSACNGDSGGPLAVQDGGSLQVGVVSFGSAAGCAI-GMPSVYARVSFFLDFI--EAN 299

  Fly   255 S 255
            |
Mosquito   300 S 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 78/253 (31%)
AgaP_AGAP005664XP_315684.2 Tryp_SPc 60..296 CDD:214473 78/253 (31%)
Tryp_SPc 61..299 CDD:238113 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.