DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CLIPB2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:268 Identity:92/268 - (34%)
Similarity:132/268 - (49%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TVPE-GLLPQLDGRIVGGSATTISSFPWQ--ISLQRSGSH---SCGGSIYSANIIVTAAHCLQSV 76
            |.|| |:  |:..||:||..|.:..|||.  |..::.|:.   .|||::.:|..|:|||||:||:
Mosquito    91 TSPECGI--QVTDRIIGGQTTELEEFPWTALIEYRKPGNQYDFHCGGALINARYILTAAHCVQSL 153

  Fly    77 SA--SVLQVRAGSTYW-------------SSGGVVAKVSSFKNHEGYNA--NTMVNDIAVIRLSS 124
            ..  .:..||.|.  |             |:|.:..::.||..|.||:|  ....||||:|||..
Mosquito   154 PRGWQLNGVRLGE--WDLSTANDCSDGICSAGPIDLEIESFVAHAGYDAADTAHTNDIALIRLRQ 216

  Fly   125 SLSFSSSIKAISLATYNPAN-----GASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASST 184
            .::.|..|:.|.|....|..     |..:..:|||...|.|:|  .:...|.:.:...|:|....
Mosquito   217 DVASSEMIRPICLPLTEPQRSRNRVGTVSFAAGWGKTESASAS--ERKLKVELTVQDPSRCRQIY 279

  Fly   185 YGYGSQIRNTMICAAA-SGKDACQGDSGGPLV--SGGV--LVGVVSWGYG-CAYSNYPGVYADVA 243
            .|....::.:.:||.. .|||.|.|||||||:  |.|.  |:||||:|.. |..:.|||||.:|.
Mosquito   280 RGINIALKASQMCAGGLQGKDTCTGDSGGPLMAKSAGAWYLIGVVSFGLSKCGTAGYPGVYTNVV 344

  Fly   244 VLRSWVVS 251
            ....|:.|
Mosquito   345 EYLDWIES 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 85/251 (34%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855
Tryp_SPc 102..350 CDD:214473 85/251 (34%)
Tryp_SPc 103..353 CDD:238113 86/254 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.