DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CLIPD6

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_312099.2 Gene:CLIPD6 / 1273147 VectorBaseID:AGAP002813 Length:484 Species:Anopheles gambiae


Alignment Length:250 Identity:81/250 - (32%)
Similarity:122/250 - (48%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSG-----SHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAG--- 86
            |:|||....::.:||...:....     |..||||:.:...::|||||::...:|   ||.|   
Mosquito   232 RVVGGVPAELNGWPWMALVGYKNTLGEVSFKCGGSLITKRHVLTAAHCIRRDLSS---VRLGEHD 293

  Fly    87 -STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL---ATYNPAN--G 145
             ||...:..:...|..:::|..|:......|:||:.:...:.||.:||.|.|   .|....|  |
Mosquito   294 TSTDAETKHIDVPVVRYESHPSYDKKDGHTDLAVLYMEFEVQFSDAIKPICLPLSETIRSKNFIG 358

  Fly   146 ASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYG-----SQIRNTMICAAA--SG 202
            .:..|:||| ||..|.|:  :.||.:.:.|::..:|.:.....|     .|..|.::||..  .|
Mosquito   359 YTPFVAGWGRTQEGGKSA--NVLQELQIPIIANDECRTLYDKIGKVFSQKQFDNAVMCAGVIEGG 421

  Fly   203 KDACQGDSGGPLVSGG--------VLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ||:|||||||||:...        ..||:||:|.|||.:..||||..||....|:
Mosquito   422 KDSCQGDSGGPLMLPQRFGTEFYYYQVGIVSYGIGCARAEVPGVYTRVASFVDWI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 80/248 (32%)
CLIPD6XP_312099.2 CLIP 25..80 CDD:288855
CLIP 114..166 CDD:288855
Tryp_SPc 232..476 CDD:214473 80/248 (32%)
Tryp_SPc 233..479 CDD:238113 80/248 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.