DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP010692

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_311408.4 Gene:AgaP_AGAP010692 / 1272495 VectorBaseID:AGAP010692 Length:271 Species:Anopheles gambiae


Alignment Length:220 Identity:70/220 - (31%)
Similarity:109/220 - (49%) Gaps:7/220 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSV-S 77
            |:|.:|.........|||:.|....|::||:.:.::......||.:|.:...:.|||||:..: .
Mosquito    30 AIGISVDINTNSSHSGRIINGKQGNIATFPYIVRMRVKNEGYCGATIITYWHVFTAAHCVYHIED 94

  Fly    78 ASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNP 142
            .:.:.:..||...:|||||...|....|..||::|:..|.|:||::::.....:|..|:|...:.
Mosquito    95 PATITMYGGSASQTSGGVVFFPSKIVIHPQYNSSTLDYDAAIIRVNNTFQGYKNIAPIALQVSDV 159

  Fly   143 ANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICA-AASGKDAC 206
            .......|.|||.....:.:.|..:||..:.:|...:|||: |.|   :....||| ..:|.|.|
Mosquito   160 PVKTKCYVIGWGWTQYATKATPDIMQYAILQVVPVKKCASA-YIY---VPKDFICAFQGNGVDIC 220

  Fly   207 QGDSGGPLVSGGVLVGVVSW-GYGC 230
            .||||||.|..|.|.|..|: |.||
Mosquito   221 HGDSGGPFVCEGKLAGATSFVGPGC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 66/204 (32%)
AgaP_AGAP010692XP_311408.4 ATP-synt_C <9..36 CDD:294318 2/5 (40%)
Tryp_SPc 46..258 CDD:214473 66/204 (32%)
Tryp_SPc 47..268 CDD:238113 65/203 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.