DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CLIPC10

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_310506.4 Gene:CLIPC10 / 1271650 VectorBaseID:AGAP000572 Length:380 Species:Anopheles gambiae


Alignment Length:297 Identity:88/297 - (29%)
Similarity:128/297 - (43%) Gaps:58/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVVCAL-------GGTV------------PEGLLPQLDGRIVGGSATTISSFPWQISL----- 48
            |..|.|.:       ||||            |.|  ..|...|..|.|.....||:..:|     
Mosquito    83 LPIVCCPVRLEPRLQGGTVAKRISVRQCEQFPNG--TGLADHIFNGVAAQFGEFPYMAALGYGAP 145

  Fly    49 --QRSGSHS---CGGSIYSANIIVTAAHCLQS----VSASVLQVRAGSTYWSSGGVVAKVSSFKN 104
              ..:|..|   ||.|:.|:..::||||||:.    ....||:::...|......:..:.::  .
Mosquito   146 NGTEAGLPSLFRCGASLISSRFLLTAAHCLRERPVFARLGVLELQPARTVDEPLDIAIRQAT--P 208

  Fly   105 HEGYNANTMVNDIAVIRLSSSLSFS-SSIKAISLATYNPANGASA------AVSGWGTQSSGSSS 162
            |..|:|.|..||||::.|:..::.. ..::.:.|.|.....|..|      :|.|||||..|.:.
Mosquito   209 HPDYHAVTYQNDIALLELAEPVTGDWPFVEPVCLYTNATGGGLEALAGQPLSVQGWGTQQPGDTE 273

  Fly   163 IPSQLQYVNVNIVSQSQCASS---TYGYGSQIRNTMICAAASGK------DACQGDSGGPL---V 215
            ..::|...||::|.:..||:|   |....:.:....:||....:      |.|.|||||||   |
Mosquito   274 PAARLMKANVSLVERDACAASIPRTRRNPTGLHPGQLCALGRNEQNETVADTCPGDSGGPLALNV 338

  Fly   216 SG-GVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVS 251
            .| ..|||:.|.||.|. |..||:|.:||....||.|
Mosquito   339 DGRHYLVGITSSGYSCG-SPIPGIYTEVARYLDWVES 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/252 (30%)
CLIPC10XP_310506.4 CLIP 45..89 CDD:197829 2/5 (40%)
Tryp_SPc 122..372 CDD:214473 75/252 (30%)
Tryp_SPc 123..375 CDD:238113 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.