DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP012692

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_307636.4 Gene:AgaP_AGAP012692 / 1269055 VectorBaseID:AGAP012692 Length:277 Species:Anopheles gambiae


Alignment Length:229 Identity:70/229 - (30%)
Similarity:111/229 - (48%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCL-QSVSASVLQVRAGSTYWSS 92
            ||||.|....|:|:|:.:.|:.:.:..||.||.:...:.|||||| ::.:.:.:.:..|||..:|
Mosquito    50 GRIVNGKNANIASYPYIVRLRVNSAGVCGASIITYTHVFTAAHCLYKNQNPASITLYGGSTSQTS 114

  Fly    93 GGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQS 157
            ||||...|....|..||..|...|..::::.:|.....:|..|:|......:..:...:|||..:
Mosquito   115 GGVVFFASKVIIHPYYNPETHNYDAGIVQIKNSFQGYKNIAPIALQDAEVPSDTTCYAAGWGYNN 179

  Fly   158 SGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASGK-DACQGDSGGPLVSGGVLV 221
            ....:.|..|||..:.::|..||:::..||.:.   ..|||..:.. |.|.||||||.|....|.
Mosquito   180 YDRKTSPDNLQYATLQVISPQQCSAAWSGYATP---QFICAQQNNNGDVCNGDSGGPFVCNDKLT 241

  Fly   222 GVVSWGYGCAYSNYPGVYADV--AVLRSWVVSTA 253
            |..|:|........|..:..|  ..:|.::.|.|
Mosquito   242 GATSYGGVACRGKLPSAFTKVFAPAIREFIRSVA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 67/222 (30%)
AgaP_AGAP012692XP_307636.4 Tryp_SPc 51..264 CDD:214473 66/215 (31%)
Tryp_SPc 52..274 CDD:238113 66/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.