DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP012473

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_307308.4 Gene:AgaP_AGAP012473 / 1268739 VectorBaseID:AGAP012473 Length:272 Species:Anopheles gambiae


Alignment Length:267 Identity:90/267 - (33%)
Similarity:135/267 - (50%) Gaps:26/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVILLSAVVCALGGTV---------PEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGS 59
            |.::|..:.|  |..|         .||  |...||||.|....||::.:.:|::.:|...||.|
Mosquito     5 ISLVLFGLFC--GNAVVTNANVQNTKEG--PSHSGRIVNGVPVNISNYKYALSMRLNGEFRCGAS 65

  Fly    60 IYSANIIVTAAHCLQSVSASVLQVR--AGSTYWSSGGVVAKVSSFKNHEGYNANTMVN----DIA 118
            |.:.:..::||||:.:::...:::.  .|||..|||||...|.....|..|..|:..|    |:|
Mosquito    66 IITCSHALSAAHCVYNLTGPRIELTLYGGSTSASSGGVEFPVVGGAIHPYYKPNSQSNTSDYDVA 130

  Fly   119 VIRL-SSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCAS 182
            ::.: ::|.|...::..::|.|.....|....|.|||..........:||.|.|:||||||.|||
Mosquito   131 ILNVPANSFSGRPNMAPLALQTKELPVGTRCFVVGWGRTGENQPVSTNQLLYANMNIVSQSSCAS 195

  Fly   183 STYGYGSQIRNT--MICAA-ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAV 244
            ....:.......  |:||. .:|.|.|:|||||.||.||.|.||||:|..|: ..:|.|:|.|..
Mosquito   196 MWANFEKLCAECKHMVCAQYYNGMDTCRGDSGGALVCGGRLTGVVSFGPYCS-GVWPSVFAKVTA 259

  Fly   245 --LRSWV 249
              :||::
Mosquito   260 PSMRSFI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 81/230 (35%)
AgaP_AGAP012473XP_307308.4 Tryp_SPc 36..266 CDD:214473 81/230 (35%)
Tryp_SPc 37..267 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.