DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and CMA1

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens


Alignment Length:240 Identity:65/240 - (27%)
Similarity:103/240 - (42%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRIVGGSATTISSFPW----QISLQRSGSHSCGGSIYSANIIVTAAHCLQ---SVSASVLQVRAG 86
            |.|:||:.....|.|:    :|......|..|||.:...|.::|||||..   :|:.....:...
Human    20 GEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEE 84

  Fly    87 STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAI---SLATYNPANGASA 148
            ...|....|:.:.    .|..||.:|:.:||.:::|....|.:.::..:   |...:.|. |...
Human    85 EDTWQKLEVIKQF----RHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPP-GRMC 144

  Fly   149 AVSGW---GTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR----NTMICAA--ASGKD 204
            .|:||   |....||.:    ||.|.:.::....|        |..|    |..:|..  ...|.
Human   145 RVAGWGRTGVLKPGSDT----LQEVKLRLMDPQAC--------SHFRDFDHNLQLCVGNPRKTKS 197

  Fly   205 ACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |.:|||||||:..||..|:||  ||.:.:..|.|:..::..|.|:
Human   198 AFKGDSGGPLLCAGVAQGIVS--YGRSDAKPPAVFTRISHYRPWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 63/237 (27%)
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 64/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.