DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Ctrl

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:276 Identity:94/276 - (34%)
Similarity:144/276 - (52%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGT----VPEGLLPQL--DGRIVGGSATTISSFPWQISLQ-RSGSHSCGG 58
            ||.:.:.||.|:  ||.:    || .:.|.|  :.|||.|......|:|||:||| .:|.|.|||
  Rat     1 MLLLSLTLSLVL--LGSSWGCGVP-AITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGFHFCGG 62

  Fly    59 SIYSANIIVTAAHCL--------------QSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYN 109
            |:.:.|.:||||||.              :|.:|..:|             |..:|....|..:|
  Rat    63 SLIAPNWVVTAAHCKVTPGRHFVILGEYDRSSNAEPIQ-------------VLSISKAITHPSWN 114

  Fly   110 ANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPA--NGASAAVSGWGTQSSGSSSIPSQLQYVNV 172
            .|||.||:.:::|:|...:::.:..:.||:.|.|  .|.:...:|||..|...:..|::||.|.:
  Rat   115 PNTMNNDLTLLKLASPARYTAQVSPVCLASSNEALPAGLTCVTTGWGRISGVGNVTPARLQQVVL 179

  Fly   173 NIVSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYS 233
            .:|:.:||...   :||:|.::||||..:|..:||||||||||    :..||:|:||||......
  Rat   180 PLVTVNQCRQY---WGSRITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTENCNV 241

  Fly   234 NYPGVYADVAVLRSWV 249
            ..|.:|..|:...:|:
  Rat   242 QAPAMYTRVSKFNTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 82/239 (34%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 82/239 (34%)
Tryp_SPc 34..260 CDD:238113 82/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.