DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and LOC116411715

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_031760387.1 Gene:LOC116411715 / 116411715 -ID:- Length:386 Species:Xenopus tropicalis


Alignment Length:267 Identity:81/267 - (30%)
Similarity:117/267 - (43%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ----RSGSHSCGGSIYSANIIVTAAHCLQ 74
            |:||......|.....|||||..:....:||.:|:|    :..||.||||:.:...::|||||.:
 Frog    25 AIGGICGNRPLFNKGSRIVGGQNSPPGKWPWMVSIQSPTGKEFSHLCGGSVLNEIWVLTAAHCFK 89

  Fly    75 SVSASVLQVRAGSTYW------------SSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127
            .     ||.:..:..|            .|...:.|:......:.||..|..|||.::||...:.
 Frog    90 H-----LQRKEETKSWRLVFGANNLKVLESSVQIRKIKEVIQPKAYNPTTEANDITLLRLDKPIV 149

  Fly   128 FSSSIKAISLAT--YNPANGASAAVSGWGT--QSSGSSSIPSQ-LQYVNVNIVSQSQCASSTYGY 187
            |:..::.....|  .|........::|||.  :.||.   ||: ||...|:.:...:|.|..: |
 Frog   150 FTDYVQPACFPTEFANVEKKTDCYIAGWGVLDEESGE---PSEILQEARVHQIDSKKCNSKDW-Y 210

  Fly   188 GSQIRNTMICAA--ASGKDACQGDSGGPLVSGG------VLVGVVSWGYGCAYSNYPGVYADVAV 244
            ...|....:||.  ..|.|:|||||||||:...      .:||:.|||.|||....||||.....
 Frog   211 DGAIGEYNLCAGHEKGGIDSCQGDSGGPLMCKTQKSRTYAVVGITSWGSGCARGKKPGVYTSTKY 275

  Fly   245 LRSWVVS 251
            ...|:.|
 Frog   276 FIKWIAS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/247 (30%)
LOC116411715XP_031760387.1 Tryp_SPc 41..280 CDD:214473 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.