DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss29

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:279 Identity:95/279 - (34%)
Similarity:141/279 - (50%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTV---PEGLLPQLDGRIVGGSATTISSFPWQISLQ------RSGSHSC 56
            ::::.:.|..:.|::.||.   |||:|.    .||||.:.....:|||:||:      ....|:|
Mouse     2 LIQLCLTLFFLGCSIAGTPAPGPEGVLM----GIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNC 62

  Fly    57 GGSIYSANIIVTAAHCLQSVSA--SVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAV 119
            ||||.....::|||||::...|  ||.::|.|..|...|..:..||....|..:....:.:|:|:
Mouse    63 GGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVAL 127

  Fly   120 IRLSSSLSFSSSIKAISLATYNPANGASAA------VSGWGTQSSGSS-SIPSQLQYVNVNIVSQ 177
            ::|:.|:....::|.:.|    |:......      |:|||..|:..| ..|.:||.|.|.|:..
Mouse   128 LQLAVSVQSFPNVKPVKL----PSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDN 188

  Fly   178 SQCASSTYGYGSQIRN--------TMICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGC 230
            |.| ...|...::.||        .|:||...|:|:|.||||||||    ....|||||||||||
Mouse   189 SLC-EEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGC 252

  Fly   231 AYSNYPGVYADVAVLRSWV 249
            |..::|||||.|.....|:
Mouse   253 ALRDFPGVYARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 86/245 (35%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 87/246 (35%)
Tryp_SPc 31..271 CDD:214473 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_117904
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.