DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Prss28

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:284 Identity:89/284 - (31%)
Similarity:130/284 - (45%) Gaps:58/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTV-----------PEGLLPQLDGRIVGGSATTISSFPWQISLQ------RSGS 53
            :||.|:.| |..||           |.|        ||||..|....:|||:||:      .|..
Mouse     4 LLLLALSC-LESTVFMASVSISRSKPVG--------IVGGQCTPPGKWPWQVSLRMYSYEVNSWV 59

  Fly    54 HSCGGSIYSANIIVTAAHCLQSVSA--SVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVND 116
            |.|||||.....|:|||||:||..|  :|.:|:.|..|......:..:|....|..||..:...|
Mouse    60 HICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFD 124

  Fly   117 IAVIRLSSSLSFSSSIKAISL----ATYNPANGASAAVSGWGT-------QSSGSSSIPSQLQYV 170
            :|:::|::.|..|:::..:||    :|::..:  ...:.|||.       |.      |.||..|
Mouse   125 LALMQLTALLVTSTNVSPVSLPKDSSTFDSTD--QCWLVGWGNLLQRVPLQP------PYQLHEV 181

  Fly   171 NVNIVSQSQC------ASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLV----SGGVLVGVVS 225
            .:.|.....|      .||.......|.:.|:||..||:..|.||||||||    :..:.|||||
Mouse   182 KIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVS 246

  Fly   226 WGYGCAYSNYPGVYADVAVLRSWV 249
            .|..|: :|.|.:::.|....:|:
Mouse   247 KGIDCS-NNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/247 (32%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 80/248 (32%)
Tryp_SPc 31..269 CDD:214473 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_117904
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.