DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and AgaP_AGAP013221

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_003436543.1 Gene:AgaP_AGAP013221 / 11175927 VectorBaseID:AGAP013221 Length:318 Species:Anopheles gambiae


Alignment Length:242 Identity:76/242 - (31%)
Similarity:111/242 - (45%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISL---QRSG-----SHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGS 87
            ||||.|.....||.|..|   :..|     |.|||||:.|...|:|||||. |....|: ||.|.
Mosquito    72 IVGGEAAKHGEFPHQALLGYPREDGSPEPYSFSCGGSLISDRFILTAAHCF-SYGDPVI-VRLGE 134

  Fly    88 ---TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAA 149
               |..|:..:...::....|..|..:...:|:|::||:.::.||..|:...|.|....|.:...
Mosquito   135 YDLTVDSTTQLDFGIAEIIRHPKYRNSRSYHDLALVRLNETVLFSKVIRPACLWTNPTLNVSRFV 199

  Fly   150 VSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCAS---STYGYGSQIRNTMICAAA--SGKDACQGD 209
            .:|:|.|..||:.:.::|..|.:::...|.|..   ....:...|....:|..:  .|||.||||
Mosquito   200 ATGFGKQEEGSTDLSTKLMKVQLDLFPSSDCGELFRDNRKFRDGIDEGQLCVGSLIGGKDTCQGD 264

  Fly   210 SGGPLVSGGV-------LVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |||||.:...       :|||.|.|..|...|...:|:.||....|:
Mosquito   265 SGGPLQTITEPRSCIYNIVGVTSTGAACGVGNSKAIYSKVAHYLDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/240 (31%)
AgaP_AGAP013221XP_003436543.1 Tryp_SPc 72..314 CDD:238113 76/242 (31%)
Tryp_SPc 72..311 CDD:214473 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.