DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and KLK11

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:281 Identity:82/281 - (29%)
Similarity:132/281 - (46%) Gaps:48/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            :|||:.....:||          :.||:.|......|.|||.:|.......||.::.:...::||
Human    38 LILLALATGLVGG----------ETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTA 92

  Fly    70 AHCLQSVSASVLQVRAGSTYWSSGGVVAKVS-------------------------SFKNHEGYN 109
            ||||:...:............||...::.:|                         ||. |.|:|
Human    93 AHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFP-HPGFN 156

  Fly   110 ANTMV-----NDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQY 169
             |::.     |||.:::::|.:|.:.:::.::|::.....|.|..:||||:.||....:|..|:.
Human   157 -NSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRC 220

  Fly   170 VNVNIVSQSQCASSTYGYGSQIRNTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGYG-CA 231
            .|:.|:...:|.::   |...|.:||:||:.  .|||:||||||||||....|.|::|||.. ||
Human   221 ANITIIEHQKCENA---YPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCA 282

  Fly   232 YSNYPGVYADVAVLRSWVVST 252
            .:..||||..|.....|:..|
Human   283 ITRKPGVYTKVCKYVDWIQET 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 75/251 (30%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 75/251 (30%)
Tryp_SPc 54..303 CDD:238113 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.