DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and F11

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:244 Identity:86/244 - (35%)
Similarity:123/244 - (50%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSV-SASVLQVRAGSTY 89
            :::.|:|||:|:....:|||::|..|..|.|||||.....|:|||||...: :...|:|..|...
Mouse   385 KINPRVVGGAASVHGEWPWQVTLHISQGHLCGGSIIGNQWILTAAHCFSGIETPKKLRVYGGIVN 449

  Fly    90 WS---SGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAA-- 149
            .|   .|....:|.....|:.|.......|||:::|.|:::::...:.|.|.:....|.....  
Mouse   450 QSEINEGTAFFRVQEMIIHDQYTTAESGYDIALLKLESAMNYTDFQRPICLPSKGDRNAVHTECW 514

  Fly   150 VSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSG 211
            |:||| |...|  .:.|.||...|.:||..:|  .|.....:|.|.||||.  ..|||.|:||||
Mouse   515 VTGWGYTALRG--EVQSTLQKAKVPLVSNEEC--QTRYRRHKITNKMICAGYKEGGKDTCKGDSG 575

  Fly   212 GPLVS--GGV--LVGVVSWGYGCAYSNYPGVYADVAVLRSWVVSTANSI 256
            |||..  .||  |||:.|||.||.....||||.:||....|::....::
Mouse   576 GPLSCKYNGVWHLVGITSWGEGCGQKERPGVYTNVAKYVDWILEKTQTV 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 85/231 (37%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519
Tryp_SPc 389..617 CDD:214473 85/231 (37%)
Tryp_SPc 390..617 CDD:238113 84/230 (37%)
Heparin-binding. /evidence=ECO:0000250 547..550 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.