DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and PRSS21

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:279 Identity:90/279 - (32%)
Similarity:132/279 - (47%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVVCALGGTVPEGL-LPQLDG---------RIVGGSATTISSFPWQISLQRSGSHSCGGSI 60
            :||:.::...|...||.. ...|.|         |||||....:..:|||.||:...||.||.|:
Human     7 LLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSL 71

  Fly    61 YSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVN---------- 115
            .|....:|||||.::.|    .:...|.:....|.:..:.||.:.:.|.....|:          
Human    72 LSHRWALTAAHCFETYS----DLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLG 132

  Fly   116 ----DIAVIRLSSSLSFSSSIKAISL--ATYNPANGASAAVSGWG-TQSSGSSSIPSQLQYVNVN 173
                |||:::||:.::::..|:.|.|  :|:...|.....|:||| .:...:...|..||.|.|.
Human   133 NSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVA 197

  Fly   174 IVSQSQC--ASSTYGYGSQIRNTMICA--AASGKDACQGDSGGPLV--SGGV--LVGVVSWGYGC 230
            |::.|.|  ....|.:...|...|:||  |..|||||.|||||||.  ..|:  .:||||||.||
Human   198 IINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGC 262

  Fly   231 AYSNYPGVYADVAVLRSWV 249
            ...|.||||.:::....|:
Human   263 GRPNRPGVYTNISHHFEWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 82/243 (34%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.