DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:258 Identity:91/258 - (35%)
Similarity:130/258 - (50%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAVVCALGGTVPEGLLP-QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHC 72
            ||.||        |::| ......|||..::...:|||.||......:||||:.:...:::||||
Zfish   293 SAAVC--------GIIPVNSSNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHC 349

  Fly    73 LQSV-SASVLQVRAG---STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIK 133
            .... :...|.|..|   ...:....:...|.:...|..||.||..||||::|||..::|:.||:
Zfish   350 FNGQRNGFYLTVILGPKTQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIR 414

  Fly   134 AISLA----TYNPANGASAAVSGWGTQSSGSSSIPSQ--LQYVNVNIVSQSQCASSTYGYGSQIR 192
            .:.||    .:|  :...:.::.|...|.| ..:||.  .|.|.|.::...|| :..||.|| |.
Zfish   415 PVCLAAEGSVFN--SDTESWITTWRNISDG-VPLPSPKIFQEVEVPVIGNRQC-NCLYGVGS-IT 474

  Fly   193 NTMICAA--ASGKDACQGDSGGPLVSG----GVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            :.||||.  ..|||.||||||||:||.    .|..|:||:|.|||.|.:||||..|:..:.|:
Zfish   475 DNMICAGLLKEGKDLCQGDSGGPMVSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 84/234 (36%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 84/232 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.