DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk5

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038952099.1 Gene:Klk5 / 102546758 RGDID:1593461 Length:293 Species:Rattus norvegicus


Alignment Length:260 Identity:86/260 - (33%)
Similarity:132/260 - (50%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTVPEGLLPQLD--------------GRIVGGSATTISSFPWQISLQRSGSH-SCGGSIYSANII 66
            ||.|.|....|:              .|||.||.....:.|||.:|....:. .||..:.:...:
  Rat    40 GTKPSGTNRDLNTDSNSGEDTRSDSSSRIVNGSDCPKDTQPWQGALLLGPNKLYCGAVLINPQWL 104

  Fly    67 VTAAHCLQSVSASVLQVRAG----STYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLS 127
            :|||||.:    .|.::|.|    |..:.||..:.:......|.||:.....||:.:|:::..:.
  Rat   105 LTAAHCRK----PVFRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIR 165

  Fly   128 FSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            .|.|:|.:.:.:..|..|....||||||.||..::.|..||.:::.::|:.:|.:|   |..||.
  Rat   166 ASHSVKPVEITSDCPKEGTRCMVSGWGTTSSSHNNFPKVLQCLDITVLSEERCKNS---YPGQID 227

  Fly   193 NTMICAA-ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVSTANS 255
            .||.||. .:|:|:||||||||::..|.|.|:|||| :.||..|.||||.::.....|:..|.:|
  Rat   228 KTMFCAGDEAGRDSCQGDSGGPVICNGKLQGLVSWGDFPCAQPNRPGVYTNLCEFVPWIKDTIHS 292

  Fly   256  255
              Rat   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 78/225 (35%)
Klk5XP_038952099.1 Tryp_SPc 67..286 CDD:214473 78/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.