DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and Klk9

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:235 Identity:78/235 - (33%)
Similarity:111/235 - (47%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTY--- 89
            |.|.||......:|.|||..|.......||.::.:...::|||||.:    ..|.||.|..:   
Mouse    20 DTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHCRK----PYLWVRLGEHHLWR 80

  Fly    90 WSSGGVVAKVSSFKNHEGYN----ANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAV 150
            |.....:..|:.|..|.|:|    ||...:||.:|||...:..:.:::.::|....|..|....:
Mouse    81 WEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLTPAVQPLNLTESRPPVGTQCLI 145

  Fly   151 SGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGP 213
            ||||:.||.....|..||..|::|:....|   .:.|...|...|:||.  ..|:.:||||||||
Mouse   146 SGWGSVSSSKLQYPMTLQCANISILDNKLC---RWAYPGHISEKMLCAGLWEGGRGSCQGDSGGP 207

  Fly   214 LVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVST 252
            ||..|.|.|:||.| ..|:....|.||.:|.....|:.||
Mouse   208 LVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIEST 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 74/228 (32%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 74/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.