DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and prss59.2

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:231 Identity:93/231 - (40%)
Similarity:131/231 - (56%) Gaps:16/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGS-TYWS 91
            |.:||||.....:|.|||.|| .||.|.||||:.|...:|:||||.:    |.|:||.|. ....
Zfish    18 DDKIVGGYECQPNSQPWQASL-NSGYHFCGGSLVSEYWVVSAAHCYK----SRLEVRLGEHNIVI 77

  Fly    92 SGGVVAKVSSFK--NHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAVSGWG 154
            :.|....::|.|  .:..|::.|:.:||.:|:||...:.:..::.::|.....|:|....|||||
Zfish    78 NEGTEQFITSEKVIRNPNYDSWTIDSDIMLIKLSKPATLNKYVQPVALPNGCAADGTMCRVSGWG 142

  Fly   155 -TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGPLVS 216
             |.||.:.|  ::||.:.:.|:|...|.:|   |...|.:||.||.  ..|||:||||||||:|.
Zfish   143 NTMSSTADS--NKLQCLEIPILSDRDCKNS---YPGMITDTMFCAGYLEGGKDSCQGDSGGPVVC 202

  Fly   217 GGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
            .|.|.|:||||||||..:.||||..|.:...|:..|
Zfish   203 NGELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIADT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 90/224 (40%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 90/224 (40%)
Tryp_SPc 21..238 CDD:238113 91/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.