DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and LOC100495541

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:255 Identity:97/255 - (38%)
Similarity:142/255 - (55%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHC-LQSVSASVLQVRAGS- 87
            |.|..|||||||.|..::|||:||:..|.|.||||:...:.|:||||| |.|.|.|..:||.|: 
 Frog    38 PLLPNRIVGGSAATEGAWPWQVSLRYKGIHICGGSVIGTHWILTAAHCFLISQSPSDFEVRLGAY 102

  Fly    88 --TYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL-ATYNP-ANGASA 148
              :..|...:..||.....:..:::::...|||:||.:|.::::..|..:.| :|.|. ..|...
 Frog   103 QLSLTSPNEITYKVDRIIVNSQFDSSSHYGDIALIRPTSPITYTPYILPVCLPSTSNSFPEGMEC 167

  Fly   149 AVSGWGTQS-SGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNT-------MICA--AASGK 203
            .|:||||.: ..:...|..||.|...::|::.| ...|..|:.:.::       .|||  ||..|
 Frog   168 WVTGWGTTAFQVNLPYPQTLQQVMTPLISRTSC-DQMYHIGTNVPSSTAIIPSDQICAGYAAGQK 231

  Fly   204 DACQGDSGGPLVS--GGV--LVGVVSWGYGCAYSNYPGVYADVAVLRSWVVS---TANSI 256
            |:||||||||||.  .|:  .:|.|:||.|||.:|.||||..|...:||:.|   |.|::
 Frog   232 DSCQGDSGGPLVCKLQGIWYQIGFVTWGDGCAIANRPGVYTLVPAYQSWLSSYNATENTV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 91/238 (38%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113 91/239 (38%)
Tryp_SPc 362..595 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.