DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and LOC100490788

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001333500.1 Gene:LOC100490788 / 100490788 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:231 Identity:85/231 - (36%)
Similarity:119/231 - (51%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASV-------LQVRA 85
            |.:||||...|..|.|||:....:|.:.||||:.|...|::||||.|.....|       |:.:.
 Frog    21 DDKIVGGYECTPHSQPWQVFFTFNGRNWCGGSLISPRWIISAAHCYQPPKTLVALLGEHDLKKKE 85

  Fly    86 GSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGASAAV 150
            |:...      .:|.:...|.||......:||.:::|:....::..::.|.:|...|.:||...|
 Frog    86 GTEQH------IQVEAAYKHFGYKDEAYDHDIMLVKLAKPAQYNQYVQPIPVARSCPTDGAKCLV 144

  Fly   151 SGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDACQGDSGGP 213
            ||:|...:.:...|.|||.:::.|:|.|.|.:|   |..||...|.||.  ...||:||||||||
 Frog   145 SGYGNLLAYNIRYPDQLQCLDLPILSDSSCKAS---YPRQISENMFCAGFLEGEKDSCQGDSGGP 206

  Fly   214 LVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            |:..|.|.||||||..||..|.|||||.|.....|:
 Frog   207 LICSGELYGVVSWGRYCARKNAPGVYAKVCNYLDWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 83/227 (37%)
LOC100490788NP_001333500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.