DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and tmprss15

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_031752048.1 Gene:tmprss15 / 100490249 XenbaseID:XB-GENE-999987 Length:994 Species:Xenopus tropicalis


Alignment Length:245 Identity:77/245 - (31%)
Similarity:128/245 - (52%) Gaps:20/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLPQLDG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCL--QSVSASVLQVR 84
            |:|...| :|||||...:.::||.:||..:...:||.|:.:...:|:||||:  :::..|..:.|
 Frog   751 LVPIKSGSKIVGGSDAALGAWPWIVSLYYNDRQTCGASLVNQEWLVSAAHCVYGRNLIPSNWKAR 815

  Fly    85 AG---STYWSSGGVVAK-VSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNP--A 143
            .|   :...:...:..: :.....:..||..|..:||.::.|...:::|..|:.|.|...:.  :
 Frog   816 LGLHTNLNLTQPQIATQMIDQIVINPQYNRRTKDSDIVMMHLQFKVNYSDYIQPICLPETDQEFS 880

  Fly   144 NGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA--ASGKDA 205
            .|.:.:::||| |||.|  .:|:.||...:.::|..:|......|  .|.:.|:|..  ..|.|.
 Frog   881 VGINCSIAGWGRTQSGG--PVPNILQEAEIPLISNHKCQQQMPEY--NITDNMVCGGYEEGGIDT 941

  Fly   206 CQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWVVS 251
            ||||||||::    :...||||.|:|||||..:.||||..|....:|:.|
 Frog   942 CQGDSGGPMMCQQNNEWFLVGVTSFGYGCAQPSRPGVYVRVTEFTNWIKS 991

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 72/233 (31%)
tmprss15XP_031752048.1 SEA 36..>103 CDD:396113
LDLa 157..190 CDD:197566
CUB 199..305 CDD:238001
MAM 321..478 CDD:395504
CUB 501..608 CDD:395345
LDLa 620..654 CDD:238060
SR 655..746 CDD:214555
Tryp_SPc 760..991 CDD:238113 73/234 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.