DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and tmprss9

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:236 Identity:90/236 - (38%)
Similarity:121/236 - (51%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGG 94
            :||||........|||.||:....|.||.:|.....:|:||||........:....|||..|...
 Frog   546 KIVGGLDAVRGEIPWQASLKEGSRHFCGATIIGDRWLVSAAHCFNQTKVDQVTAHMGSTALSGAD 610

  Fly    95 VVAKVSSFK---NHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLAT---YNPANGASAAVSGW 153
            .:|...|.|   .|..:|..|:..|:||:.|:|||:|:..::.:.|.:   ..|| |....:|||
 Frog   611 TIAIKISLKRVIQHPHFNPLTLDFDVAVLELASSLTFNKYVQPVCLPSALQKFPA-GWKCMISGW 674

  Fly   154 GTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAA-ASGK-DACQGDSGGPLV- 215
            |....|:.|.|..||..:|.|:.|..|:..   |...|...||||. ..|| |:|||||||||. 
 Frog   675 GNIKEGNVSKPEVLQKASVGIIDQKICSVL---YNFSITERMICAGFLDGKVDSCQGDSGGPLAC 736

  Fly   216 --SGGV--LVGVVSWGYGCAYSNYPGVYADVAVLRSWVVST 252
              |.|:  |.|:||||.|||.:..||||:.|..|:.|::.|
 Frog   737 EESPGIFFLAGIVSWGIGCAQAKKPGVYSRVTKLKDWILDT 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/231 (38%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473
Tryp_SPc 547..774 CDD:238113 88/230 (38%)
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.