DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and LOC100361261

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038949773.1 Gene:LOC100361261 / 100361261 -ID:- Length:248 Species:Rattus norvegicus


Alignment Length:265 Identity:78/265 - (29%)
Similarity:116/265 - (43%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVILLSAVVCALGGTVPEGLLPQLD-GRIVGGSATTISSFPW----QISLQRSGSHSCGGSIY 61
            :|:::||.:.          .|.|:.| |.|:||......|.|:    ||..:.||:.:|||.:.
  Rat     1 MKLLLLLQSF----------SLAPKTDAGEIIGGHEAKPHSRPYMAYLQIMDENSGNKTCGGFLI 55

  Fly    62 SANIIVTAAHCLQSVSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSL 126
            ....::||||||.|.....|.............|:..|.... |..|||.|:.||:.:::|....
  Rat    56 REYFVLTAAHCLGSXIIVTLGAHNIKEQEKKQQVIPMVKIIP-HPAYNAKTISNDLMLLKLKIKA 119

  Fly   127 SFSSSIKAISLATYN----PANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCAS---ST 184
            ..:|::|.::|...|    |  |....|:||| :.......|..||.|.:.:....:|.|   :.
  Rat   120 KKTSAVKTLNLPRSNVKVKP--GDVCYVAGWG-KLGPMGKFPDTLQEVELIVQEDQKCESYLTNV 181

  Fly   185 YGYGSQIRNTMICAAASG-KDAC-QGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRS 247
            |...::     .||.... |.|. |||||||||...|..|:||  |||...:.|..:..|:...|
  Rat   182 YDKANE-----KCAGEPKIKHASFQGDSGGPLVCKKVAAGIVS--YGCKDGSTPRAFTKVSTFLS 239

  Fly   248 WVVST 252
            .:..|
  Rat   240 RIKKT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 70/231 (30%)
LOC100361261XP_038949773.1 Tryp_SPc 21..244 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.