DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and cela1.1

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002933738.2 Gene:cela1.1 / 100170431 XenbaseID:XB-GENE-22064332 Length:265 Species:Xenopus tropicalis


Alignment Length:279 Identity:94/279 - (33%)
Similarity:148/279 - (53%) Gaps:44/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVILLSAVVCALGGTVPEGL-LPQLDGRIVGGSATTISSFPWQISLQ-RSG---SHSCGGSI 60
            ||::::|   .|..|||.....| ..:.:.|:|||:..:.:|:||||||| :||   ||:||||:
 Frog     1 MLRLLVL---AVLVLGGHCSGNLRFLEENSRVVGGTNASPNSWPWQISLQIQSGSGFSHTCGGSL 62

  Fly    61 YSANIIVTAAHCLQS-------VSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVN--D 116
            ...:.::|||||:..       :....|.|..|...      :..||....|..:|.|.:..  |
 Frog    63 IRTDRVLTAAHCVDRAGPFRVILGEHNLSVNEGPEQ------IIAVSKIVKHVNWNPNNVAAGWD 121

  Fly   117 IAVIRLSSSLSFSSSIKAISLATYNPANGASAA------VSGWG-TQSSGSSSIPSQLQYVNVNI 174
            ||::.|:||.|.:|:::..||    |:|||..|      ::||| |.::|  .:|:.||...:..
 Frog   122 IALLYLASSASLNSNVQLASL----PSNGAILAHNSPCIITGWGRTVTNG--PLPAILQQAPLPS 180

  Fly   175 VSQSQCASSTYGYGSQIRNTMICAAASGKDA-CQGDSGGPL--VSGGV--LVGVVSW--GYGCAY 232
            |:.:.|::|:| :||.::.:|:||...|..| |.|||||||  .:.||  :.|:.|:  ..||..
 Frog   181 VAHATCSTSSY-WGSTVKTSMVCAGGDGVTAGCNGDSGGPLNCPNNGVYEVHGIASFVSSLGCNA 244

  Fly   233 SNYPGVYADVAVLRSWVVS 251
            ...|.|:..|:....|:.|
 Frog   245 YLKPTVFTRVSAYIDWINS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 84/245 (34%)
cela1.1XP_002933738.2 Tryp_SPc 29..264 CDD:238113 85/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.