DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTry and zgc:171509

DIOPT Version :9

Sequence 1:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:260 Identity:87/260 - (33%)
Similarity:122/260 - (46%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTA 69
            ::|:..||.:.|            .:|:||......|.|||..|. .|...||||:...:.:|:|
Zfish     7 ILLIGVVVHSKG------------DKIIGGHECQPHSQPWQARLD-DGYGLCGGSLIHESWVVSA 58

  Fly    70 AHCLQS-------------VSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIR 121
            |||..|             |..:..:::|           .||.|   |..||.....|||.:|:
Zfish    59 AHCKSSSIIVHLGKHDLFVVEDTAQEIQA-----------EKVIS---HPKYNNREHNNDIMLIK 109

  Fly   122 LSSSLSFSSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            |......::::|.:.|.|.....|....|||||..   ..||.|.||.:.:.|:|::.|.|:   
Zfish   110 LREPAVINNNVKPVPLPTNCSHAGEQCLVSGWGVT---GDSISSTLQCLELPILSKADCKSA--- 168

  Fly   187 YGSQIRNTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVLRSWV 249
            ||..|...|.||.  ..|||:||||||||:|..|.|.|:||:|.|||...:||||.:|....:|:
Zfish   169 YGRVITKKMFCAGFMDGGKDSCQGDSGGPVVCNGTLKGIVSFGIGCAEPGFPGVYVEVCRYINWI 233

  Fly   250  249
            Zfish   234  233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 82/233 (35%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 82/233 (35%)
Tryp_SPc 21..234 CDD:238113 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.