DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII18 and Polr2f

DIOPT Version :9

Sequence 1:NP_524910.1 Gene:RpII18 / 48312 FlyBaseID:FBgn0003275 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_112625.1 Gene:Polr2f / 83503 RGDID:708567 Length:127 Species:Rattus norvegicus


Alignment Length:130 Identity:89/130 - (68%)
Similarity:103/130 - (79%) Gaps:11/130 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DNDD-VGGDDFDDVDED--VDEDINQEEEA-DNIEIIAPGGAGGGGVPKS--KRITTKYMTKYER 65
            ||:| ..|||||||:||  :|:..|.|||. :|:||:..|..     |::  |||||.|||||||
  Rat     3 DNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGER-----PQANQKRITTPYMTKYER 62

  Fly    66 ARVLGTRALQIAMCAPIMVELDGETDPLQIAMKELKQKKIPIIIRRYLPDHSYEDWSIDELIMVD 130
            ||||||||||||||||:||||:||||||.|||||||.:||||||||||||.|||||.:||||:.|
  Rat    63 ARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD 127

  Fly   131  130
              Rat   128  127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII18NP_524910.1 PLN00152 27..130 CDD:177755 75/105 (71%)
Polr2fNP_112625.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 24/54 (44%)
PLN00152 <26..127 CDD:177755 75/105 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338151
Domainoid 1 1.000 98 1.000 Domainoid score I7023
eggNOG 1 0.900 - - E1_COG1758
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7178
Inparanoid 1 1.050 162 1.000 Inparanoid score I4121
OMA 1 1.010 - - QHG59805
OrthoDB 1 1.010 - - D1488436at2759
OrthoFinder 1 1.000 - - FOG0004261
OrthoInspector 1 1.000 - - oto95750
orthoMCL 1 0.900 - - OOG6_101231
Panther 1 1.100 - - LDO PTHR10773
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2999
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.