DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII18 and NRPB6B

DIOPT Version :9

Sequence 1:NP_524910.1 Gene:RpII18 / 48312 FlyBaseID:FBgn0003275 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_178540.1 Gene:NRPB6B / 815006 AraportID:AT2G04630 Length:144 Species:Arabidopsis thaliana


Alignment Length:136 Identity:73/136 - (53%)
Similarity:99/136 - (72%) Gaps:5/136 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDADYDN-DDVGGDD---FDDVDEDVDEDINQEEEAD-NIEIIAPGGAGGGGVPKSKRITTKYM 60
            |.|.||:. ||:|.:|   ..:::|.|:||.:.:|..| |::.:...........:..|.|:|:|
plant     1 MADDDYNEVDDLGYEDEPAEPEIEEGVEEDADIKENDDVNVDPLETEDKVETEPVQRPRKTSKFM 65

  Fly    61 TKYERARVLGTRALQIAMCAPIMVELDGETDPLQIAMKELKQKKIPIIIRRYLPDHSYEDWSIDE 125
            |||||||:||||||||:|.||:||||:||||||:||||||:|:|||..|||||||.|||:|.:||
plant    66 TKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRQRKIPFTIRRYLPDMSYEEWGVDE 130

  Fly   126 LIMVDN 131
            ||:.|:
plant   131 LIVEDS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII18NP_524910.1 PLN00152 27..130 CDD:177755 60/103 (58%)
NRPB6BNP_178540.1 PLN00152 5..135 CDD:177755 70/129 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2692
eggNOG 1 0.900 - - E1_COG1758
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7178
Inparanoid 1 1.050 137 1.000 Inparanoid score I1817
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1488436at2759
OrthoFinder 1 1.000 - - FOG0004261
OrthoInspector 1 1.000 - - otm2793
orthoMCL 1 0.900 - - OOG6_101231
Panther 1 1.100 - - O PTHR10773
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2999
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.