DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII18 and polr2f

DIOPT Version :9

Sequence 1:NP_524910.1 Gene:RpII18 / 48312 FlyBaseID:FBgn0003275 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001002544.1 Gene:polr2f / 436817 ZFINID:ZDB-GENE-040718-279 Length:127 Species:Danio rerio


Alignment Length:128 Identity:86/128 - (67%)
Similarity:102/128 - (79%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DNDDVGGD-DFDDV-DEDVDEDIN--QEEEADNIEIIAPGGAGGGGVPKSKRITTKYMTKYERAR 67
            ||:|...| ||||| ||:..:|:.  ::|:.:|::|:.   ||.|.....|||||:|||||||||
Zfish     3 DNEDNFDDGDFDDVEDEEPLDDLENVEDEDQENVQILP---AGEGQQANQKRITTQYMTKYERAR 64

  Fly    68 VLGTRALQIAMCAPIMVELDGETDPLQIAMKELKQKKIPIIIRRYLPDHSYEDWSIDELIMVD 130
            ||||||||||||||:||||:||||||||||||||.:||||||||||||.|||||..||||:.|
Zfish    65 VLGTRALQIAMCAPVMVELEGETDPLQIAMKELKSRKIPIIIRRYLPDGSYEDWGCDELIITD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII18NP_524910.1 PLN00152 27..130 CDD:177755 73/104 (70%)
polr2fNP_001002544.1 PLN00152 <26..127 CDD:177755 73/103 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577548
Domainoid 1 1.000 102 1.000 Domainoid score I6838
eggNOG 1 0.900 - - E1_COG1758
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7178
Inparanoid 1 1.050 158 1.000 Inparanoid score I4238
OMA 1 1.010 - - QHG59805
OrthoDB 1 1.010 - - D1488436at2759
OrthoFinder 1 1.000 - - FOG0004261
OrthoInspector 1 1.000 - - oto40854
orthoMCL 1 0.900 - - OOG6_101231
Panther 1 1.100 - - LDO PTHR10773
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1176
SonicParanoid 1 1.000 - - X2999
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.