DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII18 and rpb6

DIOPT Version :9

Sequence 1:NP_524910.1 Gene:RpII18 / 48312 FlyBaseID:FBgn0003275 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_587956.1 Gene:rpb6 / 2539083 PomBaseID:SPCC1020.04c Length:142 Species:Schizosaccharomyces pombe


Alignment Length:141 Identity:73/141 - (51%)
Similarity:92/141 - (65%) Gaps:17/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ADYDNDDVGGDDFDDVDEDVDE-DINQEEEADNIEIIAPG----------------GAGGGGVPK 51
            :||:.|:..|.|...::|:||| ::..|.......:..||                ...|..|.|
pombe     2 SDYEEDEAFGMDGAVMEEEVDELEMIDENGQSQQGVSHPGEPSTTVITEDVASSKTAQSGKAVAK 66

  Fly    52 SKRITTKYMTKYERARVLGTRALQIAMCAPIMVELDGETDPLQIAMKELKQKKIPIIIRRYLPDH 116
            ..|.||.|||||||||:||||||||:|.||::|:|:|||||||||||||.|||||:::||||||.
pombe    67 EDRTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQIAMKELAQKKIPLLVRRYLPDG 131

  Fly   117 SYEDWSIDELI 127
            ||||||:.|||
pombe   132 SYEDWSVAELI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII18NP_524910.1 PLN00152 27..130 CDD:177755 64/117 (55%)
rpb6NP_587956.1 PLN00152 3..142 CDD:177755 71/138 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2098
eggNOG 1 0.900 - - E1_COG1758
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1404
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004261
OrthoInspector 1 1.000 - - oto100569
orthoMCL 1 0.900 - - OOG6_101231
Panther 1 1.100 - - LDO PTHR10773
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1176
SonicParanoid 1 1.000 - - X2999
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.