DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII18 and rpb-6

DIOPT Version :9

Sequence 1:NP_524910.1 Gene:RpII18 / 48312 FlyBaseID:FBgn0003275 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_496278.1 Gene:rpb-6 / 174630 WormBaseID:WBGene00007355 Length:137 Species:Caenorhabditis elegans


Alignment Length:138 Identity:80/138 - (57%)
Similarity:101/138 - (73%) Gaps:13/138 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDADY---DNDD-VGGDDFDDV-DEDVDEDINQEEEADNI----EIIAPGGAGGGGVPKSKRITT 57
            |:.||   |||| |..::.:|| :||.....|::|:.||:    |:...|.|    ||.|:.:||
 Worm     3 DEDDYQDMDNDDFVDDNEMEDVIEEDPQRPDNEDEDDDNVDENFELFDQGKA----VPTSEHVTT 63

  Fly    58 KYMTKYERARVLGTRALQIAMCAPIMVELDGETDPLQIAMKELKQKKIPIIIRRYLPDHSYEDWS 122
            .:|||||||||||||||||||.||:||||:||||||:||.|||||::||||:||||||.|||||.
 Worm    64 PFMTKYERARVLGTRALQIAMGAPVMVELEGETDPLEIARKELKQRRIPIIVRRYLPDGSYEDWP 128

  Fly   123 IDELIMVD 130
            .|:|.:.|
 Worm   129 TDQLQLAD 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII18NP_524910.1 PLN00152 27..130 CDD:177755 67/106 (63%)
rpb-6NP_496278.1 RNA_pol_Rpb6 <46..136 CDD:301331 63/93 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158270
Domainoid 1 1.000 89 1.000 Domainoid score I4968
eggNOG 1 0.900 - - E1_COG1758
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7178
Inparanoid 1 1.050 148 1.000 Inparanoid score I2986
Isobase 1 0.950 - 0 Normalized mean entropy S232
OMA 1 1.010 - - QHG59805
OrthoDB 1 1.010 - - D1488436at2759
OrthoFinder 1 1.000 - - FOG0004261
OrthoInspector 1 1.000 - - oto18558
orthoMCL 1 0.900 - - OOG6_101231
Panther 1 1.100 - - LDO PTHR10773
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1176
SonicParanoid 1 1.000 - - X2999
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.