| Sequence 1: | NP_725626.1 | Gene: | Pkc53E / 48311 | FlyBaseID: | FBgn0003091 | Length: | 679 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_003576.2 | Gene: | DOC2B / 8447 | HGNCID: | 2986 | Length: | 412 | Species: | Homo sapiens |
| Alignment Length: | 236 | Identity: | 76/236 - (32%) |
|---|---|---|---|
| Similarity: | 102/236 - (43%) | Gaps: | 59/236 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 103 ICPGKDKGIDSDSPKTQHNF------EPFTYAGPTFCDHCGSLLYGIYHQGLKCSACDMNVHARC 161
Fly 162 KEN-------VP------------SLC-----GCDHT-----ERRGRIYLEI---NVKENLLTVQ 194
Fly 195 IKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRIL 259
Fly 260 -IEVWDWDRTSRNDFMGALSFGI---SEIIKNPTNGWFKLL 296 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pkc53E | NP_725626.1 | C1_cPKC_rpt1 | 44..110 | CDD:410383 | 2/6 (33%) |
| C1_cPKC_rpt2 | 120..173 | CDD:410386 | 16/82 (20%) | ||
| C2_PKC_alpha_gamma | 177..307 | CDD:175992 | 52/127 (41%) | ||
| STKc_cPKC | 353..672 | CDD:270739 | |||
| DOC2B | NP_003576.2 | Mediates interaction with DYNLT1. /evidence=ECO:0000269|PubMed:9804756 | 1..90 | ||
| Negatively regulates targeting to plasma membrane. /evidence=ECO:0000250 | 1..36 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 38..123 | ||||
| C2A_Rabphilin_Doc2 | 127..250 | CDD:176000 | 20/91 (22%) | ||
| Mediates interaction with STXBP3. /evidence=ECO:0000250 | 257..375 | 49/118 (42%) | |||
| C2B_Rabphilin_Doc2 | 269..401 | CDD:176030 | 50/125 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||