DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and AGC1.7

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001185434.1 Gene:AGC1.7 / 844265 AraportID:AT1G79250 Length:555 Species:Arabidopsis thaliana


Alignment Length:521 Identity:128/521 - (24%)
Similarity:209/521 - (40%) Gaps:158/521 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 KEGRNLIPMDPNGLS-----DPYVKVKLIP-DDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDK 254
            |:..|||..:|.|.:     :|..|:...| .:..:|:....|                 ||.: 
plant    48 KKMDNLIKPEPAGFTNHHRPNPSPKIPSSPGSNMTESQSNLNT-----------------KPNN- 94

  Fly   255 DRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQDLLKLK 319
                       :.::.|..|.:.|..|.....||:                              
plant    95 -----------NNSNNNSNMSSRSNSIESTSSNPS------------------------------ 118

  Fly   320 QKPSQKKPMV---MRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKIL 381
                  ||..   :|.|.....:||...:..:||..:|.||.|..|.|.|.|.:|:...:|:|::
plant   119 ------KPHTGGDIRWDAVNTLTSKGVQLGISDFRLLKRLGYGDIGSVYLVELRGTITYFAMKVM 177

  Fly   382 KKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLF-FVMEYVNGGDL--MFQIQQF 443
            .|..:...:.:.....|:.:|:..:. |||..|:|.|:| |:.: .|||:..||:|  :.|.|..
plant   178 DKASLASRNKLLRAQTEREILSQLDH-PFLPTLYSHFET-DKFYCLVMEFCGGGNLYSLRQKQPN 240

  Fly   444 GKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGM------------- 495
            ..|.|..|.|:|:|:...|.:||..||:|||||.:|||:..|||:.::||.:             
plant   241 KCFTEDAARFFASEVLLALEYLHMLGIVYRDLKPENVLVRDDGHIMLSDFDLSLRCSVSPTLVKS 305

  Fly   496 ---------------------------C--------------KEN-----------------IVG 502
                                       |              |:|                 ::.
plant   306 SSVHAAGGGSGSSRPVGLIDEDAAVQGCIQPSTFFPRILQSSKKNRKAKSDFGLFVNGSMPELMA 370

  Fly   503 DKT---TKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDH 564
            :.|   :.:|.||.:|:|||||..:.:|.:||||.:|:.:||:|.|..||.|:........:...
plant   371 EPTNVKSMSFVGTHEYLAPEIIRGEGHGSAVDWWTFGIFIYELLYGATPFKGQGNRATLHNVIGQ 435

  Fly   565 NVSYPK--SLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKP 627
            .:.:|:  .:|..|::..||.|.|:|.||:.. ..|..:::.||||..::|..|  |...||..|
plant   436 ALRFPEVPHVSSAARDLIKGLLVKEPQKRIAY-KRGATEIKQHPFFEGVNWALI--RSATPPHVP 497

  Fly   628 K 628
            :
plant   498 E 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 19/116 (16%)
STKc_cPKC 353..672 CDD:270739 101/355 (28%)
AGC1.7NP_001185434.1 STKc_phototropin_like 144..501 CDD:270726 103/360 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.