DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and AT1G66360

DIOPT Version :10

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_564873.1 Gene:AT1G66360 / 842954 AraportID:AT1G66360 Length:174 Species:Arabidopsis thaliana


Alignment Length:97 Identity:37/97 - (38%)
Similarity:49/97 - (50%) Gaps:8/97 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDK 254
            ||.:.:..|.||...|... |||||.|::     .:.|.:||.:|..||..|||.||  |...|.
plant     7 LLRLHVIRGVNLAIRDSQS-SDPYVIVRM-----GKQKLRTRVMKKNLNTEWNEDLT--LSVTDP 63

  Fly   255 DRRILIEVWDWDRTSRNDFMGALSFGISEIIK 286
            ...:.|.|:|.||.||:|.||...|.|...::
plant    64 TLPVKIMVYDRDRFSRDDKMGDAIFHIDPFLE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 37/97 (38%)
STKc_cPKC 353..672 CDD:270739
AT1G66360NP_564873.1 C2_ArfGAP 5..150 CDD:176003 37/97 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.