DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and WAG1

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_175774.1 Gene:WAG1 / 841807 AraportID:AT1G53700 Length:476 Species:Arabidopsis thaliana


Alignment Length:341 Identity:99/341 - (29%)
Similarity:166/341 - (48%) Gaps:61/341 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 TSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKG--SEELYAIKILKKDVIIQDDDVECTMIEKR 400
            |.|....:....|..::.||.|:.|:|.|...:.  :...:|:|::.:||:.. ..:.....|..
plant    81 TLSSDGRLHLRHFKLVRHLGTGNLGRVFLCHLRDCPNPTGFALKVIDRDVLTA-KKISHVETEAE 144

  Fly   401 VLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAV--FYAAEIAAGLF 463
            :|:|.:. |||..|::..........:::|...|||...:::....:.|::.  |:|||:...|.
plant   145 ILSLLDH-PFLPTLYARIDASHYTCLLIDYCPNGDLHSLLRKQPNNRLPISPVRFFAAEVLVALE 208

  Fly   464 FLHTKGILYRDLKLDNVLLDADGHVKIADFGMC-------------------------------- 496
            :||..||:|||||.:|:|:..|||:.::||.:|                                
plant   209 YLHALGIVYRDLKPENILIREDGHIMLSDFDLCFKADVVPTFRSRRFRRTSSSPRKTRRGGGCFS 273

  Fly   497 ------KENIVGD-------KTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPP 548
                  :|.||.:       ..:|:..||.:|:|||::....:|..|||||:|:.|||||.|..|
plant   274 TEVEYEREEIVAEFAAEPVTAFSKSCVGTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLYGTTP 338

  Fly   549 FDGEDEEE-LFAAITDHNVSYPKSLSK----EAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFF 608
            |.|..:|: |...:::.:|::  :|.:    |||:..:..|.|.|.||||| :.|.:|::.|.||
plant   339 FKGGTKEQTLRNIVSNDDVAF--TLEEEGMVEAKDLIEKLLVKDPRKRLGC-ARGAQDIKRHEFF 400

  Fly   609 RRIDWEKIENREVQPP 624
            ..|.|..|.|  .:||
plant   401 EGIKWPLIRN--YKPP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 96/326 (29%)
WAG1NP_175774.1 STKc_phototropin_like 91..416 CDD:270726 97/331 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.