DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and AT1G17540

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_173197.2 Gene:AT1G17540 / 838328 AraportID:AT1G17540 Length:728 Species:Arabidopsis thaliana


Alignment Length:314 Identity:86/314 - (27%)
Similarity:137/314 - (43%) Gaps:66/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 ADDEQDLLKLKQKPSQKKPMVMRSDTNTHTSSKKDMIRATD-FNFIKVLGKGSFGKVLLAERKGS 372
            |:.|....:|.:..::.|...|....:....|.:|:..||| |:....:|:|.:|.|..|..:.:
plant   367 AEIETQKRRLVEMQARFKEQNMADSISYRRYSIRDVEGATDGFSDALKIGEGGYGPVYKAVLENT 431

  Fly   373 EELYAIKILKKDV------IIQDDDV-ECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEY 430
            .  .|||:||.||      ..|:.:| .|......|:.||..|.:     .|        .|.||
plant   432 S--VAIKLLKSDVSQGLKQFNQEIEVLSCMRHPNMVILLGACPEY-----GC--------LVYEY 481

  Fly   431 VNGGDLMFQIQQFGKFKEPVAVF-----YAAEIAAGLFFLH---TKGILYRDLKLDNVLLDADGH 487
            :..|.|  :.:.|.|...|...:     .|||||.||.|||   .:.:::||||..|:|:|....
plant   482 MENGTL--EDRLFCKDNTPPLSWRARFRIAAEIATGLLFLHQAKPEPLVHRDLKPANILIDRHFT 544

  Fly   488 VKIADFGMCK--ENIVGDKTTK--------TFCGTPDYIAPEIILYQPYG----KSVDWWAYGVL 538
            .||:|.|:.:  ...|.|..:.        |||    ||.||   ||..|    || |.:::||:
plant   545 SKISDVGLARLVPAAVADSFSNYHMTAAAGTFC----YIDPE---YQQTGMLGVKS-DLYSFGVV 601

  Fly   539 LYEMLVGQPPF------DGEDEEELFAAITDHNVS-YPKS----LSKEAKEACK 581
            |.:::...|..      :...|::....:.|..:| :|:.    |::.|.:.|:
plant   602 LLQIITAMPAMGLSHRVEKAIEKKKLREVLDPKISDWPEEETMVLAQLALQCCE 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 75/269 (28%)
AT1G17540NP_173197.2 STK_N 14..153 CDD:238947
STKc_IRAK 415..668 CDD:270968 75/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.