DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and AT5G40030

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_198819.1 Gene:AT5G40030 / 834000 AraportID:AT5G40030 Length:499 Species:Arabidopsis thaliana


Alignment Length:362 Identity:113/362 - (31%)
Similarity:169/362 - (46%) Gaps:77/362 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 SKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLAL 404
            ||.:.:....|..:|.||.|..|.|.|||.:.....:|:|::.|.::|....:.....|:.:|.|
plant   104 SKNEDLGLGHFRLLKKLGCGDIGSVYLAELREMGCFFAMKVMDKGMLIGRKKLVRAQTEREILGL 168

  Fly   405 GEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDL-MFQIQQFGK-FKEPVAVFYAAEIAAGLFFLHT 467
            .:. |||..|:|.|:|......:||:.:|||| :.:.:|.|| |.|..|.|||:|:...|.:||.
plant   169 LDH-PFLPTLYSHFETEKFSCLLMEFCSGGDLHILRQKQPGKHFSELAARFYASEVLLALEYLHM 232

  Fly   468 KGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGD----------------------------- 503
            .|::|||||.:||::..|||:.::||.:..::.|..                             
plant   233 MGVVYRDLKPENVMVREDGHIMLSDFDLSLQSFVSPTLIQSTSQPSCHIASYCIQPPCIDPSCKL 297

  Fly   504 ----------------------KTTK-------------------TFCGTPDYIAPEIILYQPYG 527
                                  ||.|                   :|.||.:|:|||||....:|
plant   298 PVACIQPSCFKPRFLNNKPRKAKTEKAGSDSLPMLIAEPTAARSMSFVGTHEYLAPEIIRGDGHG 362

  Fly   528 KSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPK-SLSKEAKEACKGFLTKQPNKR 591
            .|||||.:|:.|||:|.|:.||.|....|....:....:.:|: |:|..||:..:|.|||.|.||
plant   363 SSVDWWTFGIFLYELLTGKTPFKGNGNRETLFNVVGQPLKFPEGSISFAAKDLIRGLLTKDPKKR 427

  Fly   592 LGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPK 628
            ||. ..|..:::.||||..::|..|  |...||..||
plant   428 LGF-KKGATEIKQHPFFNNVNWALI--RSTTPPEIPK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 110/349 (32%)
AT5G40030NP_198819.1 STKc_phototropin_like 113..464 CDD:270726 111/353 (31%)
Keratin_B2_2 276..>309 CDD:372783 0/32 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.