DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and AT5G37740

DIOPT Version :10

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001190431.1 Gene:AT5G37740 / 833752 AraportID:AT5G37740 Length:178 Species:Arabidopsis thaliana


Alignment Length:102 Identity:38/102 - (37%)
Similarity:52/102 - (50%) Gaps:8/102 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LLTVQIKEGRNLIPMDPNGLSDPYV-----KVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDL 249
            ||.:.:|.|.||...|.:. ||||:     |..|:......||.|||.:|..:||.||:.||  |
plant     7 LLRIHVKRGVNLAIRDISS-SDPYIVVHCGKQNLMRLLNCWSKLKTRVVKHSVNPEWNDDLT--L 68

  Fly   250 KPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIK 286
            ...|.:..|.:.|:|:|..|.:|.||...|.|...|:
plant    69 SVTDPNLPIKLTVYDYDLLSADDKMGEAEFHIGPFIE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 38/102 (37%)
STKc_cPKC 353..672 CDD:270739
AT5G37740NP_001190431.1 C2 5..161 CDD:472691 38/102 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.