DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and CRLK2

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001078591.1 Gene:CRLK2 / 831429 AraportID:AT5G15730 Length:436 Species:Arabidopsis thaliana


Alignment Length:328 Identity:84/328 - (25%)
Similarity:135/328 - (41%) Gaps:65/328 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 DEQDLLKLKQKPSQKKPMVMRSDTNTHTS------------SKKDMIRATDFNFIKVLGKGSFGK 363
            |::...:..|.|....|...:...|.||.            :.||:.:||. ||..|||:||||.
plant    64 DDRANTESSQPPENGAPTQHQPWWNNHTKDLTVSASGIPRYNYKDIQKATQ-NFTTVLGQGSFGP 127

  Fly   364 VLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHS---------CFQ 419
            |..|..... ||.|.|:...:....|.:     .:..|..||       :||.         |..
plant   128 VYKAVMPNG-ELAAAKVHGSNSSQGDRE-----FQTEVSLLG-------RLHHRNLVNLTGYCVD 179

  Fly   420 TMDRLFFVMEYVNGGDLMFQI-----QQFGKFKEPVAVFYAAEIAAGLFFLH---TKGILYRDLK 476
            ...|: .:.|:::.|.|...:     .|...::|.:.:  |.:|:.|:.:||   ...:::||||
plant   180 KSHRM-LIYEFMSNGSLENLLYGGEGMQVLNWEERLQI--ALDISHGIEYLHEGAVPPVIHRDLK 241

  Fly   477 LDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYE 541
            ..|:|||.....|:||||:.||.:: |:.|....||..|:.|..|....|....|.:::||::.|
plant   242 SANILLDHSMRAKVADFGLSKEMVL-DRMTSGLKGTHGYMDPTYISTNKYTMKSDIYSFGVIILE 305

  Fly   542 MLVGQPPF--------------DGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRL 592
            ::....|.              ||.||......:.:.::...:.|:|.|...    :.|.|.||.
plant   306 LITAIHPQQNLMEYINLASMSPDGIDEILDQKLVGNASIEEVRLLAKIANRC----VHKTPRKRP 366

  Fly   593 GCG 595
            ..|
plant   367 SIG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 71/274 (26%)
CRLK2NP_001078591.1 S_TKc 119..373 CDD:214567 71/272 (26%)
STKc_IRAK 120..378 CDD:270968 70/271 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.