DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and D6PKL1

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_194391.1 Gene:D6PKL1 / 828768 AraportID:AT4G26610 Length:506 Species:Arabidopsis thaliana


Alignment Length:409 Identity:112/409 - (27%)
Similarity:172/409 - (42%) Gaps:94/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 SKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLAL 404
            :|..::....|..:|.||.|..|.|.|||..|:...:|:|::.|..:.....:.....|:.:|..
plant   113 TKHGVLGLNHFRLLKRLGCGDIGTVHLAELHGTRCFFAMKVMDKGALASRKKLLRAQTEREILQC 177

  Fly   405 GEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDL--MFQIQQFGKFKEPVAVFYAAEIAAGLFFLHT 467
            .:. |||..|:|.|:|......|||:..||||  :.|.|...:|.|..|.||.||:...:.:||.
plant   178 LDH-PFLPTLYSHFETEKFSCLVMEFCPGGDLHTLRQRQPGKRFSEQAAKFYVAEVLLAMEYLHM 241

  Fly   468 KGILYRDLKLDNVLLDADGHVKIADF--------------------------GMCKE-------- 498
            .||:|||||.:|||:..||||.::||                          |.|.:        
plant   242 LGIIYRDLKPENVLVRDDGHVMLSDFDLSLRCTVSPTVVRSTVLASEGQKNSGYCAQPACIQQPS 306

  Fly   499 ------------------------------------NIVGDKT---TKTFCGTPDYIAPEIILYQ 524
                                                .:|.:.|   :.:|.||.:|:|||||..:
plant   307 CISAPTTCFSPRYFSSKSKKDKKMKNETGNQVSPLPELVAEPTSARSMSFVGTHEYLAPEIIKGE 371

  Fly   525 PYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKS--LSKEAKEACKGFLTKQ 587
            .:|.:||||.:|:.|||:|.|:.||.|.........:....:.:|:|  :|..|::..:..|.|:
plant   372 GHGSAVDWWTFGIFLYELLFGKTPFKGSGNRATLFNVVGQPLRFPESPVVSFAARDLIRSLLVKE 436

  Fly   588 PNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPT 652
            |..||.. ..|..:::.||||..::|..:  |...||..|            |....|....||.
plant   437 PQHRLAY-KRGATEMKQHPFFEGVNWALV--RCASPPEIP------------KPVDYESAPATPA 486

  Fly   653 DKV-FMMNLDQSEFVGFSY 670
            ... ..:..|||.::.|.:
plant   487 AATSTSVKSDQSNYLEFDF 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 110/396 (28%)
D6PKL1NP_194391.1 STKc_phototropin_like 122..477 CDD:270726 104/370 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.