DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and ZAC

DIOPT Version :10

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_567620.1 Gene:ZAC / 827864 AraportID:AT4G21160 Length:337 Species:Arabidopsis thaliana


Alignment Length:159 Identity:48/159 - (30%)
Similarity:76/159 - (47%) Gaps:28/159 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDK 254
            ||.|.||:|.|:...|... |||||.:.|     .|.|.::..:|:.|||||||.|...: |.:.
plant   182 LLKVTIKKGTNMAIRDMMS-SDPYVVLTL-----GQQKAQSTVVKSNLNPVWNEELMLSV-PHNY 239

  Fly   255 DRRILIEVWDWDRTSRNDFMG------------ALSFGISEIIKNPTNG-WFKLLTQD----EGE 302
            . .:.::|:|:|..|.:|.||            |::||..|:..:...| |.|  :.|    |..
plant   240 G-SVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWLK--SHDNALIEDS 301

  Fly   303 YYNVPCADDEQDL-LKLKQKPSQKKPMVM 330
            ..|:.....:|:: :||:...|.:..:.|
plant   302 IINIADGKVKQEVQIKLQNVESGELELEM 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 43/133 (32%)
STKc_cPKC 353..672 CDD:270739
ZACNP_567620.1 ArfGap 18..124 CDD:350058
C2_ArfGAP 180..324 CDD:176003 46/151 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.