DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and AGD13

DIOPT Version :10

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_567292.1 Gene:AGD13 / 825881 AraportID:AT4G05330 Length:336 Species:Arabidopsis thaliana


Alignment Length:135 Identity:43/135 - (31%)
Similarity:63/135 - (46%) Gaps:29/135 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LLTVQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDK 254
            ||.|.||:|.||...|... |||||.:.|     .:.|.:|..:.:.||||||:.|...: ||..
plant   181 LLKVTIKKGTNLAIRDMMS-SDPYVVLNL-----GKQKLQTTVMNSNLNPVWNQELMLSV-PESY 238

  Fly   255 DRRILIEVWDWDRTSRNDFMG------------ALSFGISEIIKNPTNG-WFKLLTQDEGEYYNV 306
            . .:.::|:|:|..|.:|.||            |::||..|:..:...| |.|        .::.
plant   239 G-PVKLQVYDYDTFSADDIMGEADIDIQPLITSAMAFGDPEMFGDMQIGKWLK--------SHDN 294

  Fly   307 PCADD 311
            |..||
plant   295 PLIDD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 40/129 (31%)
STKc_cPKC 353..672 CDD:270739
AGD13NP_567292.1 ArfGap 18..124 CDD:350058
C2_ArfGAP 179..323 CDD:176003 43/135 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.