DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and KIPK

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001319733.1 Gene:KIPK / 824455 AraportID:AT3G52890 Length:934 Species:Arabidopsis thaliana


Alignment Length:591 Identity:153/591 - (25%)
Similarity:237/591 - (40%) Gaps:164/591 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AGPTFCDHCGSLLYGIYHQGLKCSACDMNVHARCKENVPSLCGCDHTERRGRIYLEINVKENLLT 192
            |....|..|        |..||.::.|.|..:....:.|.:|                 .::|.:
plant   379 ANQLLCQRC--------HCSLKSTSIDDNPPSYTSSHNPKIC-----------------TDSLSS 418

  Fly   193 VQIKEGRNLIPMDPNGLSDPYVKVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRR 257
            |..||..                     ...|::...:..:.                 :..:..
plant   419 VSNKEAH---------------------QGSDENSSGSCNVS-----------------QSSEAD 445

  Fly   258 ILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNG---WFKLLTQDE-GEYYNVPCADDEQDLLKL 318
            |:|...|.. :|.|..:||:   :.:..:|||:.   .|.|.::|. |:|.......:|.:|.:.
plant   446 IVIMKQDVS-SSNNSGIGAM---VEKETENPTSSEKFEFSLSSKDSLGDYSRSTSISEESNLSRF 506

  Fly   319 K--QKPSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKIL 381
            .  .||...  |.:|.:...|...:...:....||.:|.||.|..|.|.|||..|:..|:|||::
plant   507 SCGNKPHMS--MDVRWEAIKHIKVQYGSLGLRHFNLLKKLGCGDIGTVYLAELIGTNCLFAIKVM 569

  Fly   382 KKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDL-MFQIQQFGK 445
            ..:.:.:.........|:.:|.:.:. |||..|::.|.:.:....||||..|||| :.:.:|.|:
plant   570 DNEFLARRKKSPRAQAEREILKMLDH-PFLPTLYAQFTSDNLSCLVMEYCPGGDLHVLRQKQLGR 633

  Fly   446 -FKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGM---CKENIV----- 501
             |.||.|.||.|||...|.:||..||:|||||.:|:|:..|||:.:.||.:   |..|..     
plant   634 CFPEPAARFYVAEILLALEYLHMLGIIYRDLKPENILVREDGHIMLTDFDLSLRCAVNPTLVRSN 698

  Fly   502 ---------------------------------------------------GDKTTKT------- 508
                                                               ||..:||       
plant   699 SPPGKDPARISGPYNTSNCIQPFCITEPSCQVSCFSPRLSSNQQQGRKPKRGDHLSKTQQHLSRS 763

  Fly   509 ---------------FCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELF 558
                           |.||.:|:|||||..:.:|.:||||.:||||||:|.|:.||.|.:.:|..
plant   764 LPQLVAEPTEARSNSFVGTHEYLAPEIIKGEGHGAAVDWWTFGVLLYELLYGKTPFKGYNNDETL 828

  Fly   559 AAITDHNVSYPKS--LSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREV 621
            |.:...|:.:|.|  :|.:||:..:|.|.|:|..||| ...|..:::.||||..::|..|  |..
plant   829 ANVVLQNLKFPDSPLVSFQAKDLIRGLLVKEPENRLG-SEKGSVEIKRHPFFEGLNWALI--RCA 890

  Fly   622 QPPFKP 627
            .||..|
plant   891 IPPELP 896

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386 10/44 (23%)
C2_PKC_alpha_gamma 177..307 CDD:175992 20/133 (15%)
STKc_cPKC 353..672 CDD:270739 114/360 (32%)
KIPKNP_001319733.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.