DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and SGK1

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001137148.1 Gene:SGK1 / 6446 HGNCID:10810 Length:526 Species:Homo sapiens


Alignment Length:525 Identity:174/525 - (33%)
Similarity:268/525 - (51%) Gaps:94/525 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 YVKVKLIPDDKDQSKK------------------KTRTIKACLN---------PVWNETLTYD-- 248
            ::|..::..||.||..                  ::...:.||.         |..||:.:::  
Human    27 WIKSPMVSVDKHQSPSLKYTGSSMVHIPPGEPDFESSLCQTCLGEHAFQRGVLPQENESCSWETQ 91

  Fly   249 ---------------LKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQ 298
                           .||:.:      ..|..|..:   ||.....|:::.|:...|.       
Human    92 SGCEVREPCNHANILTKPDPR------TFWTNDDPA---FMKQRRMGLNDFIQKIANN------- 140

  Fly   299 DEGEYYNVPCADDE-QDLLKLKQ-------------KPSQKKPMVMRSDTNTHTSSKKDMIRATD 349
                  :..|...| |.:||:.|             .||..:.:.:...:|.|.       :.:|
Human   141 ------SYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHA-------KPSD 192

  Fly   350 FNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQL 414
            |:|:||:|||||||||||..|..|..||:|:|:|..|::..:.:..|.|:.||....|.||||.|
Human   193 FHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGL 257

  Fly   415 HSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDN 479
            |..|||.|:|:||::|:|||:|.:.:|:...|.||.|.|||||||:.|.:||:..|:|||||.:|
Human   258 HFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPEN 322

  Fly   480 VLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLV 544
            :|||:.||:.:.|||:|||||..:.||.||||||:|:|||::..|||.::||||..|.:|||||.
Human   323 ILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLY 387

  Fly   545 GQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFR 609
            |.|||...:..|::..|.:..:....:::..|:...:|.|.|...||||......| ::.|.||.
Human   388 GLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFME-IKSHVFFS 451

  Fly   610 RIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSE----KTDLTPTDKVFMMNLDQS--EFVGF 668
            .|:|:.:.|:::.|||.|.:....|:.:||.:||.|    ....:|...:...::.::  .|:||
Human   452 LINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGF 516

  Fly   669 SYMNP 673
            ||..|
Human   517 SYAPP 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 19/137 (14%)
STKc_cPKC 353..672 CDD:270739 141/324 (44%)
SGK1NP_001137148.1 S_TKc 193..450 CDD:214567 122/257 (47%)
STKc_SGK 197..519 CDD:270727 140/322 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.