DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and PRKCH

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_006246.2 Gene:PRKCH / 5583 HGNCID:9403 Length:683 Species:Homo sapiens


Alignment Length:656 Identity:281/656 - (42%)
Similarity:363/656 - (55%) Gaps:139/656 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRLRKGALKKKNVFNVKDHCFIARFFKQPTFCSHCKDFICGYQSGYAWMGFGKQGFQCQVCSYVV 92
            :|.|:.|:::: |..:..|.|:|.:.:|||:||||::||        |..|||||:|||||:.||
Human   155 TRKRQRAMRRR-VHQINGHKFMATYLRQPTYCSHCREFI--------WGVFGKQGYQCQVCTCVV 210

  Fly    93 HKRCHEYVTFICPGKD--KGIDSDSPKTQ------HNFEPFTYAGPTFCDHCGSLLYGIYHQGLK 149
            |||||..:...|..::  ..:||...:.:      |.|....|..|||||||||||:||..|||:
Human   211 HKRCHHLIVTACTCQNNINKVDSKIAEQRFGINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQ 275

  Fly   150 CSACDMNVHARCKENVPSLCGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPMDPNGLSDPYV 214
            |..|.||||.||:.||...||             :|..|...|:   .|..|.|           
Human   276 CKICKMNVHIRCQANVAPNCG-------------VNAVELAKTL---AGMGLQP----------- 313

  Fly   215 KVKLIPDDKDQSKKKTRTIKACLNPVWNETLTYDLKPEDKDRRILIEVWDWDRTSRNDFMGALSF 279
                                                                        |.:| 
Human   314 ------------------------------------------------------------GNIS- 317

  Fly   280 GISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQDLLKLKQKPSQKKPMVMRSDTNTHTSSKKDM 344
                    ||:   ||::               :..|:.:.|.|.|       :.|....:..:.
Human   318 --------PTS---KLVS---------------RSTLRRQGKESSK-------EGNGIGVNSSNR 349

  Fly   345 IRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPP 409
            :...:|.||:||||||||||:||..|.:.:|||:|:||||||:|||||||||.|||:|:|....|
Human   350 LGIDNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHP 414

  Fly   410 FLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRD 474
            ||.||..||||.||||||||:||||||||.||:..:|.|..|.||||||.:.|.|||.|||:|||
Human   415 FLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRD 479

  Fly   475 LKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLL 539
            |||||||||.:||.|:||||||||.|....||.|||||||||||||:....||.:|||||.||||
Human   480 LKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAMGVLL 544

  Fly   540 YEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLG-CGSSGEEDVR 603
            ||||.|..||:.|:|::||.||.:..|.||..|.::|....|.|:||.|..||| ....||..:.
Human   545 YEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQGGEHAIL 609

  Fly   604 LHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGF 668
            .||||:.|||.::.:|:::|||:|:||.|:||||||..|..|:..|||.|:..:..::|.||..|
Human   610 RHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNF 674

  Fly   669 SYMNPE 674
            ||::||
Human   675 SYVSPE 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383 31/67 (46%)
C1_cPKC_rpt2 120..173 CDD:410386 31/52 (60%)
C2_PKC_alpha_gamma 177..307 CDD:175992 12/129 (9%)
STKc_cPKC 353..672 CDD:270739 192/319 (60%)
PRKCHNP_006246.2 C2_PKC_epsilon 8..140 CDD:175981
C1_1 172..225 CDD:278556 31/60 (52%)
C1_1 246..298 CDD:278556 31/64 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..342 7/46 (15%)
S_TKc 355..614 CDD:214567 163/258 (63%)
STKc_nPKC_eta 359..681 CDD:270742 193/322 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 1 1.000 - - X125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.