DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and dop

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster


Alignment Length:366 Identity:125/366 - (34%)
Similarity:196/366 - (53%) Gaps:35/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 TNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIE 398
            |.|.:.:::...:..||:.:|::..|::|.|.|.:.|.:.:.:|:|.:.|:.:|..:.||....|
  Fly   819 TATGSGAQQPSPQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVFAE 883

  Fly   399 KRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLF 463
            :.:|:..:. ||:|.::..|:|...|..|||||.|||....::..|.....:|.||.||....:.
  Fly   884 RDILSFADN-PFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVE 947

  Fly   464 FLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVG----------DKTTKTFC-----GTP 513
            :||:.||::||||.||:|:.|.||:|:.|||:.|..::.          |..|:.|.     |||
  Fly   948 YLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDKQVYGTP 1012

  Fly   514 DYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKS----LSK 574
            :|||||:||.|.|||.||||:.|::|||.|:|..||.||..|||||...:.::.:|.|    :..
  Fly  1013 EYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHTVNDDIEWPDSEDWPVQA 1077

  Fly   575 EAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFD 639
            |||:.....|.:.|..|||. .||..:::.|.:|..:||..:..::.:  |.|::.|..|.|.||
  Fly  1078 EAKDIISQLLQQNPRDRLGT-QSGALEMKEHEYFLGMDWNSLLRQKAE--FVPQLSHDDDTSYFD 1139

  Fly   640 KQFTSEKTDL-----TPTDKVFMMNLDQSEFVGFSYMNPEY 675
            .:......||     ..||       |...|..|:...|:|
  Fly  1140 TRMDRYNHDLGGEDTDDTD-------DTPVFGSFNSYTPQY 1173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 119/342 (35%)
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 105/282 (37%)
S_TKc 835..1110 CDD:214567 103/276 (37%)
PDZ_signaling 1506..1587 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.