DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and akt2

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_937789.1 Gene:akt2 / 378972 ZFINID:ZDB-GENE-031007-5 Length:479 Species:Danio rerio


Alignment Length:336 Identity:149/336 - (44%)
Similarity:217/336 - (64%) Gaps:5/336 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 SSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLA 403
            :..:..:..:||:::|:||||:||||:|...|.:...||:|||:|:|||..|:|..|:.|.|||.
Zfish   139 TKSRTKVTMSDFDYLKLLGKGTFGKVILVREKATGMYYAMKILRKEVIIAKDEVAHTITESRVLQ 203

  Fly   404 LGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTK 468
             ..:.|||..|...|||.|||.|||||.|||:|.|.:.:...|.|..|.||.|||.:.|.:||:|
Zfish   204 -NTRHPFLTTLKYAFQTRDRLCFVMEYANGGELFFHLSRERVFTEDRARFYGAEIVSALEYLHSK 267

  Fly   469 GILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWW 533
            .::||||||:|::||.|||:||.|||:|||.|..:.|.|||||||:|:|||::....||::||||
Zfish   268 DVVYRDLKLENLMLDKDGHIKITDFGLCKEGITNEATMKTFCGTPEYLAPEVLEDNDYGRAVDWW 332

  Fly   534 AYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSG 598
            ..||::|||:.|:.||..:|.|.||..|....:.:|::||.|||....|.|.|.|.:|||.|...
Zfish   333 GLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRNLSPEAKALLAGLLKKDPKQRLGGGPED 397

  Fly   599 EEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLD-- 661
            .::|..|.||..::|:.:..:::.|||||::....|...||.:||::...:||.|:...::.:  
Zfish   398 AKEVMTHKFFNNMNWQDVLQKKLVPPFKPQVTSETDTRYFDDEFTAQTITVTPPDQYDSLDAEDP 462

  Fly   662 --QSEFVGFSY 670
              ::.|..|||
Zfish   463 DTRTHFSQFSY 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992
STKc_cPKC 353..672 CDD:270739 147/322 (46%)
akt2NP_937789.1 PH_PKB 4..111 CDD:269947
PH 6..106 CDD:278594
S_TKc 150..407 CDD:214567 128/257 (50%)
STKc_PKB_beta 154..476 CDD:173686 147/321 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.