DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and Akt2

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:XP_008757330.1 Gene:Akt2 / 25233 RGDID:2082 Length:496 Species:Rattus norvegicus


Alignment Length:389 Identity:161/389 - (41%)
Similarity:237/389 - (60%) Gaps:23/389 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 YNVPCADDEQDLLK--------LKQKPSQKKPMVMR----SDTNTH------TSSKKDMIRATDF 350
            ::|...|:.::.::        |||:...:..|..:    ||::|.      .|..:..:...||
  Rat   103 FHVDSPDEREEWIRAIQMVANSLKQRGPGEDAMDYKCGSPSDSSTSEMMEVAVSKARAKVTMNDF 167

  Fly   351 NFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLH 415
            :::|:||||:||||:|...|.:...||:|||:|:|||..|:|..|:.|.|||. ..:.|||..|.
  Rat   168 DYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQ-NTRHPFLTALK 231

  Fly   416 SCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNV 480
            ..|||.|||.|||||.|||:|.|.:.:...|.|..|.||.|||.:.|.:||::.::|||:||:|:
  Rat   232 YAFQTHDRLCFVMEYANGGELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENL 296

  Fly   481 LLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVG 545
            :||.|||:||.|||:|||.|....|.|||||||:|:|||::....||::||||..||::|||:.|
  Rat   297 MLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCG 361

  Fly   546 QPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRR 610
            :.||..:|.|.||..|....:.:|::|..|||....|.|.|.|.:|||.|.|..::|..|.||..
  Rat   362 RLPFYNQDHERLFELILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLS 426

  Fly   611 IDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTPTDK---VFMMNLDQ-SEFVGFSY 670
            |:|:.:..:::.|||||::....|...||.:||::...:||.|:   :..:.||| :.|..|||
  Rat   427 INWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSY 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 0/2 (0%)
STKc_cPKC 353..672 CDD:270739 149/322 (46%)
Akt2XP_008757330.1 PH_PKB 32..126 CDD:269947 2/22 (9%)
PH 35..121 CDD:278594 2/17 (12%)
S_TKc 167..424 CDD:214567 126/257 (49%)
STKc_PKB_beta 171..493 CDD:173686 149/321 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.