DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc53E and SGK3

DIOPT Version :9

Sequence 1:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001028750.1 Gene:SGK3 / 23678 HGNCID:10812 Length:496 Species:Homo sapiens


Alignment Length:501 Identity:183/501 - (36%)
Similarity:260/501 - (51%) Gaps:69/501 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 VKLIPDDKDQSKKKTRTIKACLNPV----W--------NETLTYDLKPE-------DKDRRILIE 261
            |.:...|:.:.|||..|:...|..|    |        .:.|...||.:       ...:||..:
Human    16 VSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGD 80

  Fly   262 VWDWDRTSRNDFMGALSFGISEIIKN----PTNGWFKLLTQDEGEYYNVPCADDEQDLLKLKQKP 322
            .:|      .||:.....|::|.|:|    |             |.||.|   |.:..|::....
Human    81 NFD------PDFIKQRRAGLNEFIQNLVRYP-------------ELYNHP---DVRAFLQMDSPK 123

  Fly   323 SQKKPMV---MRSDTNTHTSSKKDMI--------RATDFNFIKVLGKGSFGKVLLAERKGSEELY 376
            .|..|..   .||....|::|:...:        :.|||:|:||:|||||||||||:||...:.|
Human   124 HQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFY 188

  Fly   377 AIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQ 441
            |:|:|:|.:::...:.:..|.|:.||....|.||||.||..|||.::|:||:::||||:|.|.:|
Human   189 AVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQ 253

  Fly   442 QFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTT 506
            :...|.|..|.|||||||:.|.:||:..|:|||||.:|:|||:.|||.:.|||:|||.|....||
Human   254 RERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTT 318

  Fly   507 KTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKS 571
            .||||||:|:|||:|..|||..:||||..|.:|||||.|.|||...|..|::..|....:|....
Human   319 TTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPG 383

  Fly   572 LSKEAKEACKGFLTKQPNKRLGCGSSGEED---VRLHPFFRRIDWEKIENREVQPPFKPKIKHRK 633
            :|..|....:..|.|....|||    .:||   ::.||||..:.|..:..:::.|||.|.:....
Human   384 VSLTAWSILEELLEKDRQNRLG----AKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPD 444

  Fly   634 DVSNFDKQFTSEKT--DLTPTDKVFMMNLDQSE----FVGFSYMNP 673
            |:.|||..||.|..  .:..:....::|....|    ||||||..|
Human   445 DIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383
C1_cPKC_rpt2 120..173 CDD:410386
C2_PKC_alpha_gamma 177..307 CDD:175992 25/113 (22%)
STKc_cPKC 353..672 CDD:270739 144/327 (44%)
SGK3NP_001028750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 1/4 (25%)
PX_CISK 12..120 CDD:132780 28/125 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156 6/34 (18%)
STKc_SGK3 165..490 CDD:270755 144/328 (44%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614710at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.